PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10171_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 244aa    MW: 27719.9 Da    PI: 9.5676
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10171_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.4e-201372357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq++ Le+l+++  r+p+a+++++++ +l    +++ ++V++WFqN++a++++
  RrC10171_p1 13 SRWNPTKEQITLLENLYKEgIRTPNADQIQQITGRLrvhgHIEGKNVFYWFQNHKARQRQ 72
                 8*****************99**************************************97 PP

2Wus_type_Homeobox1147.7e-371174265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi++Le+lyk+G+rtPn+++iq+it +L+ +G+ie+kNVfyWFQN+kaR+rqkq
        RrC10171_p1 11 SSSRWNPTKEQITLLENLYKEGIRTPNADQIQQITGRLRVHGHIEGKNVFYWFQNHKARQRQKQ 74
                       579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.527873IPR001356Homeobox domain
SuperFamilySSF466898.98E-12979IPR009057Homeodomain-like
SMARTSM003897.1E-51077IPR001356Homeobox domain
PfamPF000468.8E-181372IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-71372IPR009057Homeodomain-like
CDDcd000861.41E-51474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MENEGKAGTV SSSRWNPTKE QITLLENLYK EGIRTPNADQ IQQITGRLRV HGHIEGKNVF  60
YWFQNHKARQ RQKQKQERIA YFNRFLHKTS RFFRPPLCSN GTPYYLQQVG DHHNQHGHGS  120
VYRHGNNVMN PSGGYDKLTI TDHKKQLSDM TTAAARMAMP SSSLRFDRFT LRDHGYNGED  180
INVNSNGRKT LPLFPLQPLD VASDDCVRNS SCAPGHDSPV TCFGDGGGRE QPFIDFFSGC  240
SSRF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619939.11e-158PREDICTED: WUSCHEL-related homeobox 2-like
RefseqXP_013713627.11e-158PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K11e-129WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A0D3AL061e-158A0A0D3AL06_BRAOL; Uncharacterized protein
STRINGAT5G59340.11e-127(Arabidopsis thaliana)
STRINGAl_scaffold_0008_24271e-127(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-124WUSCHEL related homeobox 2